Product Information
66813-1-PBS targets DIO2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24057 Product name: Recombinant human DIO2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 171-273 aa of BC074882 Sequence: AIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKRUKKTRLAG Predict reactive species |
Full Name | deiodinase, iodothyronine, type II |
Calculated Molecular Weight | 273 aa, 31 kDa |
Observed Molecular Weight | 30-35 kDa |
GenBank Accession Number | BC074882 |
Gene Symbol | DIO2 |
Gene ID (NCBI) | 1734 |
RRID | AB_2882156 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q92813 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Type II iodothyronine deiodinase(DIO2), belongs to the iodothyronine deiodinase family, with two isoform of 30 and 34 kDa. DIO2 can activates thyroid hormone by converting the prohormone thyroxine (T4) by outer ring deiodination (ORD) to bioactive 3,3',5-triiodothyronine (T3). DIO2 is thought to be responsible for the 'local' production of T3, and thus important in influencing thyroid hormone action in these tissues.