DIS3 Polyclonal antibody

• 

  WB analysis using 14689-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14689-1-AP (DIS3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse ovary using 14689-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 14689-1-AP (DIS3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 14689-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 14689-1-AP (DIS3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 14689-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 14689-1-AP (DIS3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 14689-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DIS3 antibody (14689-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HeLa using 14689-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 14689-1-AP (DIS3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

DIS3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14689-1-AP

Publications(17)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

KIAA1008, EXOSC11, EC:3.1.13.-, dis3p, Dis-3

---

Tested Applications

• Positive WB detected in: HEK-293T cells, mouse ovary tissue, mouse testis tissue, HeLa cells, Jurkat cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 13 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

14689-1-AP targets DIS3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, drosophila
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6117

  Product name: Recombinant human DIS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 607-958 aa of BC056143

  Sequence: TTSLRGLNKLAKILKKRRIEKGALTLSSPEVRFHMDSETHDPIDLQTKELRETNSMVEEFMLLANISVAKKIHEEFSEHALLRKHPAPPPSNYEILVKAARSRNLEIKTDTAKSLAESLDQAESPTFPYLNTLLRILATRCMMQAVYFCSGMDNDFHHYGLASPIYTHFTSPIRRYADVIVHRLLAVAIGADCTYPELTDKHKLADICKNLNFRHKMAQYAQRASVAFHTQLFFKSKGIVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNMDLNGPKKKKMKLGK

• Full Name: DIS3 mitotic control homolog (S. cerevisiae)
• Calculated Molecular Weight: 109 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC056143
• Gene Symbol: DIS3
• Gene ID (NCBI): 22894
• RRID: AB_2091025
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2L1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DIS3, also named as KIAA1008 and RRP44, belongs to the ribonuclease II (RNB) family. It is a component of the exosome 3'->5' exoribonuclease complex. DIS3 is required for the 3'-processing of the 7S pre-RNA to the mature nuclear complex. It is also associated with the GTPase Ran. DIS3 has a 3'-5' exonuclease activity.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; A role for the Perlman syndrome exonuclease Dis3l2 in the Lin28-let-7 pathway.; Authors - Chang Hao-Ming HM
human	WB	Mol Cell; DGCR8 Acts as an Adaptor for the Exosome Complex to Degrade Double-Stranded Structured RNAs.; Authors - Sara Macias
human	WB	Sci Adv; Enhanced packaging of U6 small nuclear RNA and splicing-related proteins into extracellular vesicles during HIV infection; Authors - Yiyao Huang
mouse	WB	Nucleic Acids Res; RNA-regulatory exosome complex confers cellular survival to promote erythropoiesis.; Authors - Charu Mehta
mouse	IF	Proc Natl Acad Sci U S A; The early macrophage response to pathogens requires dynamic regulation of the nuclear paraspeckle; Authors - Sikandar Azam ; KD Validated
human	WB	EMBO J; The RNA exosome complex degrades expanded hexanucleotide repeat RNA in C9orf72 FTLD/ALS.; Authors - Yuya Kawabe ; KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Tsimafei (Verified Customer) (07-15-2022)

30µg of total protein lysate were loaded on the gel. Primary antibodies were incubated ON at 4C.

• Applications: Western Blot
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: mESCs

DIS3 Antibody Western Blot validation (1:3000 dilution) in mESCs (Cat no:14689-1-AP)