DIS3L2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86034-1-RR (same clone as 86034-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86034-1-RR (DIS3L2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86034-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86034-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86034-1-RR against Human DIS3L2 were performed. The affinity constant is 0.463 nM.

DIS3L2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86034-1-PBS

Clone No.250578A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

DIS3 like exonuclease 2, DIS3-like exonuclease 2, EC:3.1.13.-, FAM6A, hDIS3L2

---

Product Information

86034-1-PBS targets DIS3L2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30634

  Product name: Recombinant human DIS3L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 99-201 aa of BC036113

  Sequence: VVARNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLSVCVSEKG

• Full Name: DIS3 mitotic control homolog (S. cerevisiae)-like 2
• Observed Molecular Weight: 99 kDa
• GenBank Accession Number: BC036113
• Gene Symbol: DIS3L2
• Gene ID (NCBI): 129563
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IYB7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.