Product Information
86034-1-PBS targets DIS3L2 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag30634 Product name: Recombinant human DIS3L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 99-201 aa of BC036113 Sequence: VVARNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLSVCVSEKG Predict reactive species |
| Full Name | DIS3 mitotic control homolog (S. cerevisiae)-like 2 |
| Observed Molecular Weight | 99 kDa |
| GenBank Accession Number | BC036113 |
| Gene Symbol | DIS3L2 |
| Gene ID (NCBI) | 129563 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8IYB7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



