DLD Polyclonal antibody

• 

  WB analysis of HeLa using 16431-1-AP

  WB result of DLD antibody (16431-1-AP; 1:60000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DLD transfected HeLa cells.

• 

  WB analysis using 16431-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16431-1-AP (DLD antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16431-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16431-1-AP (DLD antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16431-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16431-1-AP (DLD Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16431-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16431-1-AP (DLD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 16431-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 16431-1-AP (DLD antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 16431-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 16431-1-AP (DLD antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 16431-1-AP

  IP result of anti-DLD (IP:16431-1-AP, 4ug; Detection:16431-1-AP 1:1000) with mouse liver tissue lysate 6000ug.

• 

  IHC staining of human liver cancer using 16431-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16431-1-AP (DLD antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 16431-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16431-1-AP (DLD antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 16431-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 16431-1-AP (DLD antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human heart using 16431-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 16431-1-AP (DLD antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human kidney using 16431-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 16431-1-AP (DLD antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human kidney using 16431-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 16431-1-AP (DLD antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human testis using 16431-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 16431-1-AP (DLD antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human testis using 16431-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 16431-1-AP (DLD antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human liver using 16431-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16431-1-AP (DLD antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human liver using 16431-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16431-1-AP (DLD antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human liver cancer using 16431-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16431-1-AP (DLD antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 16431-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16431-1-AP (DLD antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 16431-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DLD antibody (16431-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

• 

  IF Staining of HepG2 using 16431-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DLD antibody (16431-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

DLD Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16431-1-AP

Publications(36)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

DLDH, EC:1.8.1.4, GCSL, LAD, PHE3

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, human brain tissue, human liver tissue, L02 cells, mouse heart tissue, mouse liver tissue, rat liver tissue, rat heart tissue
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human liver cancer tissue, human heart tissue, human kidney tissue, human testis tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:10000-1:500000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 31 publications below
• IHC: See 5 publications below
• IF: See 2 publications below
• IP: See 2 publications below
• CoIP: See 1 publications below

Product Information

16431-1-AP targets DLD in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9729

  Product name: Recombinant human DLD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 160-509 aa of BC018696

  Sequence: NQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

• Full Name: dihydrolipoamide dehydrogenase
• Calculated Molecular Weight: 509 aa, 54 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC018696
• Gene Symbol: DLD
• Gene ID (NCBI): 1738
• RRID: AB_2091888
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09622
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DLD(Dihydrolipoyl dehydrogenase, mitochondrial) is also named as GCSL, LAD, PHE3 and belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It catalyzes the oxidation of dihydrolipoamide, hE3 uses two molecules : non-covalently bound FAD and a transiently bound substrate, NAD+. DLD is involved in the hyperactivation of spermatazoa during capacitation and in the spermatazoal acrosome reaction.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Res; Hypoxia induces mitochondrial protein lactylation to limit oxidative phosphorylation; Authors - Yunzi Mao
		Science; Copper induces cell death by targeting lipoylated TCA cycle proteins.; Authors - Peter Tsvetkov
mouse	WB	Nat Cell Biol; RIP3 targets pyruvate dehydrogenase complex to increase aerobic respiration in TNF-induced necroptosis; Authors - ; KO Validated
human	WB	J Hepatol; OGDHL silencing promotes hepatocellular carcinoma by reprogramming glutamine metabolism.; Authors - Weiqi Dai
human	WB	Nat Commun; Blocking glycine utilization inhibits multiple myeloma progression by disrupting glutathione balance.; Authors - Jiliang Xia ; KD Validated
human	WB	Redox Biol; Transketolase in human Müller cells is critical to resist light stress through the pentose phosphate and NRF2 pathways.; Authors - Yingying Chen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Hua (Verified Customer) (07-12-2023)

Great antibody for WB. Very strong signal and very clean background.

• Applications: Western Blot
• Primary Antibody Dilution: 1:4000
• Cell Tissue Type: Mouse liver

DLD Antibody Western Blot validation (1:4000 dilution) in Mouse liver (Cat no:16431-1-AP)