• Featured Product
  • KD/KO Validated

DLD Polyclonal antibody

DLD Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 16431-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

DLDH, EC:1.8.1.4, GCSL, LAD, PHE3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HeLa cells, human brain tissue, human liver tissue, L02 cells, mouse heart tissue, mouse liver tissue, rat liver tissue, rat heart tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman liver cancer tissue, human heart tissue, human kidney tissue, human testis tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:10000-1:500000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16431-1-AP targets DLD in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9729

Product name: Recombinant human DLD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 160-509 aa of BC018696

Sequence: NQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

Predict reactive species
Full Name dihydrolipoamide dehydrogenase
Calculated Molecular Weight 509 aa, 54 kDa
Observed Molecular Weight 56 kDa
GenBank Accession NumberBC018696
Gene Symbol DLD
Gene ID (NCBI) 1738
RRIDAB_2091888
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP09622
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DLD(Dihydrolipoyl dehydrogenase, mitochondrial) is also named as GCSL, LAD, PHE3 and belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It catalyzes the oxidation of dihydrolipoamide, hE3 uses two molecules : non-covalently bound FAD and a transiently bound substrate, NAD+. DLD is involved in the hyperactivation of spermatazoa during capacitation and in the spermatazoal acrosome reaction.

Protocols

Product Specific Protocols
IF protocol for DLD antibody 16431-1-APDownload protocol
IHC protocol for DLD antibody 16431-1-APDownload protocol
IP protocol for DLD antibody 16431-1-APDownload protocol
WB protocol for DLD antibody 16431-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Cell Res

Hypoxia induces mitochondrial protein lactylation to limit oxidative phosphorylation

Authors - Yunzi Mao

Science

Copper induces cell death by targeting lipoylated TCA cycle proteins.

Authors - Peter Tsvetkov
mouseWB

Nat Cell Biol

RIP3 targets pyruvate dehydrogenase complex to increase aerobic respiration in TNF-induced necroptosis

Authors -
  • KO Validated
humanWB

J Hepatol

OGDHL silencing promotes hepatocellular carcinoma by reprogramming glutamine metabolism.

Authors - Weiqi Dai
humanWB

Nat Commun

Blocking glycine utilization inhibits multiple myeloma progression by disrupting glutathione balance.

Authors - Jiliang Xia
  • KD Validated
humanWB

Redox Biol

Transketolase in human Müller cells is critical to resist light stress through the pentose phosphate and NRF2 pathways.

Authors - Yingying Chen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Hua (Verified Customer) (07-12-2023)

Great antibody for WB. Very strong signal and very clean background.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000
  • Cell Tissue Type: Mouse liver
DLD Antibody Western Blot validation (1:4000 dilution) in Mouse liver (Cat no:16431-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...