CoraLite® Plus 488-conjugated DLD Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-16431

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 DLD antibody (CL488-16431) at dilution of 1:100.

• Featured Product
• KD/KO Validated

DLD Polyclonal Antibody for IF/ICC

Cat No. CL488-16431

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

dihydrolipoamide dehydrogenase, DLD, DLDH, E3, GCSL, LAD, PHE3

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-16431 targets DLD in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9729

  Product name: Recombinant human DLD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 160-509 aa of BC018696

  Sequence: NQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

• Full Name: dihydrolipoamide dehydrogenase
• Calculated Molecular Weight: 509 aa, 54 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC018696
• Gene Symbol: DLD
• Gene ID (NCBI): 1738
• RRID: AB_3672652
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09622
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

DLD(Dihydrolipoyl dehydrogenase, mitochondrial) is also named as GCSL, LAD, PHE3 and belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It catalyzes the oxidation of dihydrolipoamide, hE3 uses two molecules : non-covalently bound FAD and a transiently bound substrate, NAD+. DLD is involved in the hyperactivation of spermatazoa during capacitation and in the spermatazoal acrosome reaction.