DLK1 Monoclonal antibody

DLK1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67923-1-Ig
Clone No.2C3H8

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IHC, ELISA

pG2, FA1, DLK-1, DLK 1, DLK

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJAR cells, human placenta tissue, pig adrenal gland tissue, NCCIT cells
Positive IHC detected inhuman pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67923-1-Ig targets DLK1 in WB, IHC, ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30916

Product name: Recombinant human DLK1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 242-383 aa of BC007741

Sequence: LTCVKKRALSPQQVTRLPNGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLAVNIIFPEKIDMTTFSKEAGDEEI

Predict reactive species
Full Name delta-like 1 homolog (Drosophila)
Calculated Molecular Weight 41 kDa
Observed Molecular Weight45-60 kDa
GenBank Accession NumberBC007741
Gene Symbol DLK1
Gene ID (NCBI) 8788
RRIDAB_2918675
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP80370
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DLK1, also named PREF1, FA1, or pG2, is a transmembrane protein belonging to the epidermal growth factor (EGF)-like superfamily (PMID: 8095043). It contains six EGF-like repeats in the extracellular region. DLK1 is abundant in preadipocytes and regulate adipocyte differentiation negatively (PMID: 8500166). Deficiency of DLK1 gives rise to growth retardation and accelerated adiposity in mouse model. Expression of DLK1 is found in tumors with neuroendocrine features that implies DLK1 may be involved in neuroendocrine differentiation (PMID: 8095043). It has been reported overexpression of DLK1 could lead to the development of metabolic abnormalities by impairment of adipocyte function in mice (PMID: 12588883). The gene of DLK1 maps to chromosome 14q32, and encodes a 383-amino acid protein with a calculated molecular mass of 41 kDa. In preadipocytes, multiple discrete forms of DLK1 protein of 45-60 kDa are present, owing in part to N-linked glycosylation (PMID: 8500166).

Protocols

Product Specific Protocols
IHC protocol for DLK1 antibody 67923-1-IgDownload protocol
WB protocol for DLK1 antibody 67923-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...