DLX6 Polyclonal antibody

• 

  WB analysis of NCCIT using 23216-1-AP

  NCCIT cell were subjected to SDS PAGE followed by western blot with 23216-1-AP (DLX6 Antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse embryo using 23216-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 23216-1-AP (DLX6 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse embryo using 23216-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 23216-1-AP (DLX6 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse embryo using 23216-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 23216-1-AP (DLX6 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

DLX6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23216-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ChIP, ELISA

Synonyms

Homeobox protein DLX-6

---

Tested Applications

• Positive WB detected in: NCCIT cell
• Positive IHC detected in: mouse embryo tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• ChIP: See 1 publications below

Product Information

23216-1-AP targets DLX6 in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19724

  Product name: Recombinant human DLX6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 110-175 aa of BC069363

  Sequence: QGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM

• Full Name: distal-less homeobox 6
• Calculated Molecular Weight: 175 aa, 20 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC069363
• Gene Symbol: DLX6
• Gene ID (NCBI): 1750
• RRID: AB_2879233
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P56179
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncol Rep; DANCR promotes glioma cell autophagy and proliferation via the miR‑33b/DLX6/ATG7 axis; Authors - Wei Yu ; KD Validated
human	IF,ChIP	Nat Commun; The transcriptional regulatory network modulating human trophoblast stem cells to extravillous trophoblast differentiation; Authors - Mijeong Kim
human	WB,IHC	Front Immunol; The key role of DLX6 in nasopharyngeal carcinoma: metastasis, angiogenesis and tumor immune mechanism; Authors - Hanxuan Yang