Tested Applications
Positive WB detected in | NCCIT cell |
Positive IHC detected in | mouse embryo tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 2 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
ChIP | See 1 publications below |
Product Information
23216-1-AP targets DLX6 in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19724 Product name: Recombinant human DLX6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 110-175 aa of BC069363 Sequence: QGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM Predict reactive species |
Full Name | distal-less homeobox 6 |
Calculated Molecular Weight | 175 aa, 20 kDa |
Observed Molecular Weight | 32 kDa |
GenBank Accession Number | BC069363 |
Gene Symbol | DLX6 |
Gene ID (NCBI) | 1750 |
RRID | AB_2879233 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P56179 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for DLX6 antibody 23216-1-AP | Download protocol |
IHC protocol for DLX6 antibody 23216-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Oncol Rep DANCR promotes glioma cell autophagy and proliferation via the miR‑33b/DLX6/ATG7 axis
| ||
Nat Commun The transcriptional regulatory network modulating human trophoblast stem cells to extravillous trophoblast differentiation | ||
Front Immunol The key role of DLX6 in nasopharyngeal carcinoma: metastasis, angiogenesis and tumor immune mechanism |