DNAH5 Polyclonal antibody

• 

  IHC staining of human lung using 31079-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 31079-1-AP (DNAH5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 31079-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 31079-1-AP (DNAH5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 31079-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using DNAH5 antibody (31079-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HepG2 using 31079-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using DNAH5 antibody (31079-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

DNAH5 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 31079-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

CILD3, Ciliary dynein heavy chain 5, DNAHC5, Dynein heavy chain 5, axonemal, HL1

---

Tested Applications

• Positive IHC detected in: human lung tissue, mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, HepG2 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31079-1-AP targets DNAH5 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34647

  Product name: Recombinant human DNAH5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-150 aa of NM_001369

  Sequence: LNKTEVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPDNIHQEVSF

• Full Name: dynein, axonemal, heavy chain 5
• Calculated Molecular Weight: 529 kDa
• GenBank Accession Number: NM_001369
• Gene Symbol: DNAH5
• Gene ID (NCBI): 1767
• RRID: AB_3669844
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8TE73
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Dynein axonemal heavy chain 5 (DNAH5) is an axonemal heavy chain dynein, part of a microtubule-associated motor protein complex. DNAH5 is a large gene comprising 79 exons and one alternative first exon and encodes a heavy chain of the ODA. We have recently shown that recessive DNAH5 mutations are responsible for PCD characterized by ODA defects. DNAH5 mutations cause PCD and randomization of left-right asymmetry (PMID: 15750039).