Tested Applications
| Positive IHC detected in | human lung tissue, mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31079-1-AP targets DNAH5 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34647 Product name: Recombinant human DNAH5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 50-150 aa of NM_001369 Sequence: LNKTEVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPDNIHQEVSF Predict reactive species |
| Full Name | dynein, axonemal, heavy chain 5 |
| Calculated Molecular Weight | 529 kDa |
| GenBank Accession Number | NM_001369 |
| Gene Symbol | DNAH5 |
| Gene ID (NCBI) | 1767 |
| RRID | AB_3669844 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q8TE73 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Dynein axonemal heavy chain 5 (DNAH5) is an axonemal heavy chain dynein, part of a microtubule-associated motor protein complex. DNAH5 is a large gene comprising 79 exons and one alternative first exon and encodes a heavy chain of the ODA. We have recently shown that recessive DNAH5 mutations are responsible for PCD characterized by ODA defects. DNAH5 mutations cause PCD and randomization of left-right asymmetry (PMID: 15750039).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DNAH5 antibody 31079-1-AP | Download protocol |
| IHC protocol for DNAH5 antibody 31079-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







