Tested Applications
Positive WB detected in | mouse testis tissue, rat testis |
Positive IHC detected in | mouse testis tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:12000 |
Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
IF | See 1 publications below |
Product Information
25118-1-AP targets DNAJB13 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, canine samples.
Tested Reactivity | human, mouse, rat, canine |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18934 Product name: Recombinant human DNAJB13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 204-316 aa of BC153176 Sequence: PNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQALLT Predict reactive species |
Full Name | DnaJ (Hsp40) related, subfamily B, member 13 |
Calculated Molecular Weight | 316 aa, 36 kDa |
Observed Molecular Weight | 32-36 kDa |
GenBank Accession Number | BC153176 |
Gene Symbol | DNAJB13 |
Gene ID (NCBI) | 374407 |
RRID | AB_2879906 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P59910 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for DNAJB13 antibody 25118-1-AP | Download protocol |
IHC protocol for DNAJB13 antibody 25118-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Assist Reprod Genet A novel homozygous mutation in DNAJB13-a gene associated with the sperm axoneme-leads to teratozoospermia. | ||
Cell Rep Differential requirements of IQUB for the assembly of radial spoke 1 and the motility of mouse cilia and flagella | ||