Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells, NIH/3T3 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
Product Information
31492-1-AP targets DNAJC13 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35412 Product name: Recombinant human DNAJC13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1300-1400 aa of BC043583 Sequence: DDAYEVLNLPQGQGPHDESKIRKAYFRLAQKYHPDKNPEGRDMFEKVNKAYEFLCTKSAKIVDGPDPENIILILKTQSILFNRHKEDLQPYKYAGYPMLIR Predict reactive species |
| Full Name | DnaJ (Hsp40) homolog, subfamily C, member 13 |
| Observed Molecular Weight | 254 kDa |
| GenBank Accession Number | BC043583 |
| Gene Symbol | DNAJC13 |
| Gene ID (NCBI) | 23317 |
| RRID | AB_3670005 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | O75165 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DNAJC13 is a large protein with 2,243 amino acids. Due to the presence of the central DNAJ domain, DNAJC13 binds HSC70 (heat shock cognate 70) and acts as a co-chaperone in mediating HSC70 cellular functions. Within the cell, DNAJC13 is primarily localized at membranous structures. This interaction is mediated, at least in part, by the binding to phosphoinositides (PI) through its N-terminal sequence. RME-8/DNAJC13 is involved in several endosomal functions such as protein sorting, endosomal tubulation, transport processes including the retrograde transport from the endosome to the trans-Golgi network (TGN), the formation of endosomal degradative microdomains, and the recycling of membrane receptors. (PMID: 32322926)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DNAJC13 antibody 31492-1-AP | Download protocol |
| WB protocol for DNAJC13 antibody 31492-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



