DNAJC15 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse liver using 16063-1-AP (same clone as 16063-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16063-1-AP (DNAJC15 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16063-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 16063-1-AP (same clone as 16063-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 16063-1-AP (DNAJC15 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16063-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16063-1-AP (same clone as 16063-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16063-1-AP (DNAJC15 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16063-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16063-1-AP (same clone as 16063-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16063-1-AP (DNAJC15 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16063-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16063-1-AP (same clone as 16063-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16063-1-AP (DNAJC15 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16063-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16063-1-AP (same clone as 16063-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16063-1-AP (DNAJC15 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16063-1-PBS in a different storage buffer formulation.

DNAJC15 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16063-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

16063-1-PBS targets DNAJC15 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8911

  Product name: Recombinant human DNAJC15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC010910

  Sequence: MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQGLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH

• Full Name: DnaJ (Hsp40) homolog, subfamily C, member 15
• Calculated Molecular Weight: 150 aa, 16 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC010910
• Gene Symbol: DNAJC15
• Gene ID (NCBI): 29103
• RRID: AB_10598307
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5T4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.