DNAJC15 Polyclonal antibody

• 

  WB analysis of mouse liver using 16063-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16063-1-AP (DNAJC15 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 16063-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 16063-1-AP (DNAJC15 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 16063-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16063-1-AP (DNAJC15 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 16063-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16063-1-AP (DNAJC15 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 16063-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16063-1-AP (DNAJC15 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 16063-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16063-1-AP (DNAJC15 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

DNAJC15 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16063-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

DNAJC15, DNAJD1, HSD18, MCJ

---

Tested Applications

• Positive WB detected in: mouse liver tissue, human brain tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

16063-1-AP targets DNAJC15 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8911

  Product name: Recombinant human DNAJC15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC010910

  Sequence: MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQGLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH

• Full Name: DnaJ (Hsp40) homolog, subfamily C, member 15
• Calculated Molecular Weight: 150 aa, 16 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC010910
• Gene Symbol: DNAJC15
• Gene ID (NCBI): 29103
• RRID: AB_10598307
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5T4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Cell Death Dis; HIF2α drives ccRCC metastasis through transcriptional activation of methylation-controlled J protein and enhanced prolegumain secretion; Authors - Tianyu Shen
human	WB	Cancers (Basel); Mutant p53 Depletion by Novel Inhibitors for HSP40/J-Domain Proteins Derived from the Natural Compound Plumbagin; Authors - Mohamed Alalem