DOCK11 Recombinant monoclonal antibody

• 

  WB analysis using 85022-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85022-3-RR (DOCK11 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 85022-3-RR

  K-562 cells were subjected to SDS PAGE followed by western blot with 85022-3-RR (DOCK11 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 85022-3-RR

  RAW264.7 cells were subjected to SDS PAGE followed by western blot with 85022-3-RR (DOCK11 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 85022-3-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 85022-3-RR (DOCK11 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 85022-3-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 85022-3-RR (DOCK11 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 85022-3-RR

  Biolayer interferometry (BLl) kinetic assays of 85022-3-RR against Human DOCK11 were performed. The affinity constant is below 1 pM.

DOCK11 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 85022-3-RR

Clone No.242575H5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

242575H5, ACG, bB128O4.1, dedicator of cytokinesis 11, ZIZ2

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells, RAW 264.7 cells, HEK-293 cells, Jurkat cells
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85022-3-RR targets DOCK11 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35831

  Product name: Recombinant human DOCK11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 250-400 aa of NM_144658

  Sequence: HYLAAETEQEMEEWLITLKKIIQINTDSLVQEKKETVETAQDDETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQRLDFSGIEPDIKPFEEKCNKRFLVNCHDLTFNILGQIGDNAKGPPTNVEPFFINL

• Full Name: dedicator of cytokinesis 11
• Calculated Molecular Weight: 238 kDa
• Observed Molecular Weight: 238 kDa
• GenBank Accession Number: NM_144658
• Gene Symbol: DOCK11
• Gene ID (NCBI): 139818
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5JSL3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DOCK11(also known as Zizimin2) is a member of CDM (Ced-5, DOCK180, and Myoblast City) family guanine nucleotide exchange factor mainly expressed in immune cells. As a guanine nucleotide exchange factor, DOCK11 activated the rho family GTPase cell division cycle 42 (CDC42), resulting in cytoskeletal reorganization.