DPEP3 Polyclonal antibody

• 

  WB analysis using 31585-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 31585-1-AP (DPEP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

DPEP3 Polyclonal Antibody for WB, ELISA

Cat No. 31585-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

MBD3, dipeptidase 3

---

Tested Applications

• Positive WB detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31585-1-AP targets DPEP3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36039

  Product name: Recombinant human DPEP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-93 aa of NM_001370198.1

  Sequence: RQPVTRAETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDG

• Full Name: dipeptidase 3
• Calculated Molecular Weight: 54kDa，488aa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: NM_001370198.1
• Gene Symbol: DPEP3
• Gene ID (NCBI): 64180
• RRID: AB_3670045
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9H4B8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Dipeptidase 3 (DPEP3) is a member of the dipeptidase family. It is normally expressed restricted to the testis and is involved in the hydrolytic metabolism of dipeptides (PMID: 32325220).