Anti-Human DR5/CD262 Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human DR5/CD262 Rabbit Recombinant Antibody, PBS Only (98273-1-PBS)

• 

  FC experiment of human PBMCs using 98273-1-RR (same clone as 98273-1-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human DR5/CD262 Rabbit RecAb (98273-1-RR, Clone: 242319H8) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with CoraLite® Plus 647 Anti-Human CD14 Rabbit Recombinant Antibody (CL647-98040, Clone: 230332D7). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98273-1-PBS in a different storage buffer formulation.

• 

  FC experiment of human PBMCs using 98273-1-RR (same clone as 98273-1-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human DR5/CD262 Rabbit RecAb (98273-1-RR, Clone: 242319H8) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98273-1-PBS in a different storage buffer formulation.

DR5/CD262 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98273-1-PBS

Clone No.242319H8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

DR5, 242319H8, CD262, Death receptor 5, KILLER

---

Product Information

98273-1-PBS targets DR5/CD262 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1648

  Product name: Recombinant Human DR5 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 56-182 aa of BC001281

  Sequence: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

• Full Name: tumor necrosis factor receptor superfamily, member 10b
• Calculated Molecular Weight: 48 kDa
• GenBank Accession Number: BC001281
• Gene Symbol: DR5
• Gene ID (NCBI): 8795
• RRID: AB_3745939
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O14763
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DR5, also known as CD262, TNFRSF10B, TRAILR2, TRICK2 and KILLER, is a widely expressed single-pass type I membrane protein belonging to the tumour necrosis factor receptor superfamily (TNFRSF). It is a receptor for TNF-related apoptosis-inducing ligand (TRAIL), which is a member of the tumor necrosis factor (TNF) family of cytokines and induces apoptosis in a wide variety of cells (PMID: 9311998). DR5 contains two extracellular cysteine-rich repeats, typical for TNF receptor (TNFR) family members, and a cytoplasmic death domain (DD), through which DR5 is capable to transmit the apoptotic signal (PMID: 9311998; 20531300).