Product Information
83037-5-PBS targets DRD1 in Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag12366 Product name: Recombinant human DRD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 338-446 aa of BC074978 Sequence: RKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT Predict reactive species |
Full Name | dopamine receptor D1 |
Calculated Molecular Weight | 446 aa, 49 kDa |
GenBank Accession Number | BC074978 |
Gene Symbol | DRD1 |
Gene ID (NCBI) | 1812 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P21728 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |