Tested Applications
| Positive WB detected in | mouse brain tissue, pig brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
28094-1-AP targets DRD4 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Pig, mouse samples.
| Tested Reactivity | Human, Pig, mouse |
| Cited Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26930 Product name: Recombinant human DRD4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 221-320 aa of NM_000797 Sequence: MRWEVARRAKLHGRAPRRPSGPGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRG Predict reactive species |
| Full Name | dopamine receptor D4 |
| Calculated Molecular Weight | 44 kDa |
| Observed Molecular Weight | 40-44 kDa |
| GenBank Accession Number | NM_000797 |
| Gene Symbol | DRD4 |
| Gene ID (NCBI) | 1815 |
| RRID | AB_2881058 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21917 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The family of dopamine receptors (DRs) includes five G protein-coupled receptors (GPCRs)-DRD1, DRD2, DRD3, DRD4 and DRD5-with different anatomical distribution, expression levels, dopamine affinity, signal transduction, and effector targets (PMID:36523297). DRD4 (dopamine receptor D4) influences the postsynaptic action of dopamine and is implicated in many neurological processes, exhibits polymorphism and is one of the most studied genes in connection with psychiatric disorders (PMID:21873960). Moreover, DRD4 modulate glucose metabolism, and protect neurocytes from anoxia/reoxygenation (A/R) injury. Thus, DRD4 might regulate myocardial I/R injury in association with GLUT4-mediated glucose metabolism (PMID:33584304).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for DRD4 antibody 28094-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Aging (Albany NY) Sepsis induced cognitive impairments by disrupting hippocampal parvalbumin interneuron-mediated inhibitory network via a D4-receptor mechanism. | ||
Invest Ophthalmol Vis Sci Distinct Transcriptomic Profiles of Cultured Anterior and Posterior Populations of Human Infant Scleral Fibroblasts: Including Dopamine Receptors |



