Product Information
28094-1-PBS targets DRD4 in WB, Indirect ELISA applications and shows reactivity with human, mouse, pig samples.
| Tested Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26930 Product name: Recombinant human DRD4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 221-320 aa of NM_000797 Sequence: MRWEVARRAKLHGRAPRRPSGPGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRG Predict reactive species |
| Full Name | dopamine receptor D4 |
| Calculated Molecular Weight | 44 kDa |
| Observed Molecular Weight | 40-44 kDa |
| GenBank Accession Number | NM_000797 |
| Gene Symbol | DRD4 |
| Gene ID (NCBI) | 1815 |
| RRID | AB_2881058 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21917 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
The family of dopamine receptors (DRs) includes five G protein-coupled receptors (GPCRs)-DRD1, DRD2, DRD3, DRD4 and DRD5-with different anatomical distribution, expression levels, dopamine affinity, signal transduction, and effector targets (PMID:36523297). DRD4 (dopamine receptor D4) influences the postsynaptic action of dopamine and is implicated in many neurological processes, exhibits polymorphism and is one of the most studied genes in connection with psychiatric disorders (PMID:21873960). Moreover, DRD4 modulate glucose metabolism, and protect neurocytes from anoxia/reoxygenation (A/R) injury. Thus, DRD4 might regulate myocardial I/R injury in association with GLUT4-mediated glucose metabolism (PMID:33584304).



