Tested Applications
| Positive WB detected in | Jurkat cells, A431 cells, HepG2 cells, HeLa cells |
| Positive IHC detected in | human oesophagus tissue, human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 8 publications below |
| IHC | See 4 publications below |
| IF | See 4 publications below |
Product Information
13876-1-AP targets Desmocollin 2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4956 Product name: Recombinant human DSC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-357 aa of BC063291 Sequence: LIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTAANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTR Predict reactive species |
| Full Name | desmocollin 2 |
| Calculated Molecular Weight | 100 kDa |
| Observed Molecular Weight | 110-120 kDa |
| GenBank Accession Number | BC063291 |
| Gene Symbol | Desmocollin 2 |
| Gene ID (NCBI) | 1824 |
| RRID | AB_2877983 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q02487 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Desmocollin 2 (DSC2) is a member of the desmocollin subfamily of the cadherin superfamily. The desmocollins (DSC1-3), along with the desmogleins (DSG1-4), are found primarily in epithelial and cardiac muscle where they constitute the adhesive proteins of the intercellular desmosome junctions and are required for cell adhesion and desmosome formation. Mutations in the DSC2 gene are associated with arrhythmogenic right ventricular dysplasia-11.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Desmocollin 2 antibody 13876-1-AP | Download protocol |
| IHC protocol for Desmocollin 2 antibody 13876-1-AP | Download protocol |
| WB protocol for Desmocollin 2 antibody 13876-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Dev Cell Essential Functions of Glycans in Human Epithelia Dissected by a CRISPR-Cas9-Engineered Human Organotypic Skin Model. | ||
Sci Total Environ Environmental cadmium impairs blood-testis barrier via activating HRI-responsive mitochondrial stress in mice. | ||
Br J Cancer Mapping of truncated O-glycans in cancers of epithelial and non-epithelial origin. | ||
Bioconjug Chem Transforms of Cell Surface Glycoproteins Charge Influences Tumor Cell Metastasis via Atypically Inhibiting Epithelial-Mesenchymal Transition Including Matrix Metalloproteinases and Cell Junctions | ||
Mol Ther Oncolytics Exosomal miR-205-5p enhances angiogenesis and nasopharyngeal carcinoma metastasis by targeting desmocollin-2. | ||
Adv Sci (Weinh) Excessive MYC Orchestrates Macrophages induced Chromatin Remodeling to Sustain Micropapillary-Patterned Malignancy in Lung Adenocarcinoma |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Chi (Verified Customer) (08-18-2025) | The antibody was used to detect Desmocollin in human iPSC-derived cardiomyocytes by IF. It worked just fine, but it gave us significant background noise.
![]() |
FH Kiara (Verified Customer) (07-28-2025) | This primary antibody did not pass internal validation for IF and it did indeed not give us a reliable signal for IF of methanol fixed iPSC-cardiomyocytes.
![]() |
FH Jane (Verified Customer) (02-03-2022) | One specific band was found around 120kDa, however, the signal is weak so need to use lower dilution
|

















