DSG3 Polyclonal antibody

• 

  WB analysis using 29942-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29942-1-AP (DSG3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse tongue using 29942-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse tongue tissue slide using 29942-1-AP (DSG3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse tongue using 29942-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse tongue tissue slide using 29942-1-AP (DSG3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung squamous cell carcinoma using 29942-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung squamous cell carcinoma tissue slide using 29942-1-AP (DSG3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HaCaT using 29942-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HaCaT cells using DSG3 antibody (29942-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red).

• 

  IF Staining of HaCaT using 29942-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HaCaT cells using DSG3 antibody (29942-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red).

DSG3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29942-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PVA, DSG 3, Desmoglein-3, Desmoglein 3, CDHF6

---

Tested Applications

• Positive WB detected in: A431 cells, HaCaT cells
• Positive IHC detected in: mouse tongue tissue, human lung squamous cell carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HaCaT cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

29942-1-AP targets DSG3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30880

  Product name: Recombinant human DSG3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 760-880 aa of NM_001944

  Sequence: SGQSGTMRTRHSTGGTNKDYADGAISMNFLDSYFSQKAFACAEEDDGQEANDCLLIYDNEGADATGSPVGSVGCCSFIADDLDDSFLDSLGPKFKKLAEISLGVDGEGKEVQPPSKDSGYG

• Full Name: desmoglein 3 (pemphigus vulgaris antigen)
• Calculated Molecular Weight: 108 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: NM_001944
• Gene Symbol: DSG3
• Gene ID (NCBI): 1830
• RRID: AB_3086196
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P32926
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DSG3, Desmoglein-3, is the component of intercellular desmosome junctions. Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG3 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. DSG3 is expressed in the basal lower layers of in the skin epidermis (PMID: 30528827). It acts as a prognostic marker of Esophageal Squamous cell carcinoma (PMID:24568510).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Discov Oncol; Identification of KRT16 and ANXA10 as cell cycle regulation genes for lung adenocarcinoma based on self-transcriptome sequencing of surgical samples and TCGA public data mining; Authors - Wen-Jian Liu