DTL Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of HeLa using 83107-1-RR (same clone as 83107-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DTL antibody (83107-1-RR, Clone: 230144C9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83107-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83107-1-RR (same clone as 83107-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug DTL Recombinant antibody (83107-1-RR, Clone:230144C9) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 83107-1-PBS in a different storage buffer formulation.

DTL Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), Indirect ELISA

Cat No. 83107-1-PBS

Clone No.230144C9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Indirect ELISA

Synonyms

Denticleless protein homolog, DDB1- and CUL4-associated factor 2, DCAF2, CDW1, CDT2

---

Product Information

83107-1-PBS targets DTL in IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33391

  Product name: Recombinant human DTL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-240 aa of BC033540

  Sequence: MLFNSVLRQPQLGVLRNGWSSQYPLQSLLTGYQCSGNDEHTSYGETGVPVPPFGCTFSSAPNMEHVLAVANEEGFVRLYNTESQSFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVKAGELIGTCKGHQCSLKSVAFSKFEKAVFCTGGRDGNIMVWDTRCNKKDGFYRQVNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLVSAGAVDGII

• Full Name: denticleless homolog (Drosophila)
• Calculated Molecular Weight: 730 aa, 79 kDa
• GenBank Accession Number: BC033540
• Gene Symbol: DTL
• Gene ID (NCBI): 51514
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NZJ0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CDT2, also named as L2DTL or RAMP, is one of the substrate receptors of the Cullin Ring Ubiquitin Ligase 4 that targets for ubiquitin mediated degradation a number of substrates, such as CDT1, p21 and CHK1, involved in the regulation of cell cycle and survival. CDT2 overexpression was reported in breast (PMID: 18542055), gastric (PMID: 19672268) and ovarian carcinomas (PMID: 23995842) and rhabdomyosarcomas (PMID: 19235922) and associated with the aggressiveness of hepatocellular carcinomas (PMID: 17106265).