DTNB Polyclonal antibody

• 

  WB analysis of mouse skeletal muscle using 12045-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 12045-1-AP (DTNB antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 12045-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 12045-1-AP (DTNB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 12045-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 12045-1-AP (DTNB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 12045-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 12045-1-AP (DTNB antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

DTNB Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12045-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Beta dystrobrevin, DTN B, DTNB, Dystrobrevin beta, dystrobrevin, beta

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, mouse liver tissue, NIH/3T3 cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

12045-1-AP targets DTNB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2675

  Product name: Recombinant human DTNB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-306 aa of BC016655

  Sequence: MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIYYQLNKRLPSTHQISVEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQRKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKEHSSWKSPAKKLSHAISKS

• Full Name: dystrobrevin, beta
• Calculated Molecular Weight: 560 aa, 64 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC016655
• Gene Symbol: DTNB
• Gene ID (NCBI): 1838
• RRID: AB_2093901
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60941
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Neurobiol; Characterization of Dystrophin Dp71 Expression and Interaction Partners in Embryonic Brain Development: Implications for Duchenne/Becker Muscular Dystrophy; Authors - Takahiro Fujimoto