DUSP5 Polyclonal antibody

• 

  WB analysis using 30256-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30256-1-AP (DUSP5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A549 using 30256-1-AP

  IP result of anti-DUSP5 (IP:30256-1-AP, 4ug; Detection:30256-1-AP 1:500) with A549 cells lysate 1200 ug.

DUSP5 Polyclonal Antibody for WB, IP, ELISA

Cat No. 30256-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

VH3, HVH3, EC:3.1.3.16, DUSP, Dual specificity phosphatase 5

---

Tested Applications

• Positive WB detected in: A549 cells, HCT 116 cells
• Positive IP detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30256-1-AP targets DUSP5 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32997

  Product name: Recombinant human DUSP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 311-384 aa of NM_004419

  Sequence: LQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC

• Full Name: dual specificity phosphatase 5
• Calculated Molecular Weight: 42kd
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: NM_004419
• Gene Symbol: DUSP5
• Gene ID (NCBI): 1847
• RRID: AB_3669707
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16690
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DUSP5 (Dual specificity protein phosphatase 5) is also named as VH3. DUSP5, a member of DUSPs superfamily, is located in the nucleus and plays crucially regulatory roles in the signaling pathway transduction (PMID: 34169608). DUSP5 promotes the osteogenic differentiation of mesenchymal stromal cells (MSCs) by repressing SMAD1 signaling pathway in a SCP1/2‐dependent manner (PMID: 34169608). DUSP5, which specifically dephosphorylates extracellular signal-regulated kinase (ERK1/2), blocks pulmonary vascular smooth muscle cell proliferation (PMID: 34142888). DUSP5, an ERK1/2-specific endogenous phosphatase, was expressed at low levels in CRC (PMID: 36526622). DUSP5, a member of the DUSP subfamily, is known to regulate cellular inflammation (PMID: 33361528).