Product Information
15049-1-AP targets DYNLRB1 in IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7032 Product name: Recombinant human DYNLRB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-96 aa of BC002481 Sequence: MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE Predict reactive species |
| Full Name | dynein, light chain, roadblock-type 1 |
| Calculated Molecular Weight | 11 kDa |
| GenBank Accession Number | BC002481 |
| Gene Symbol | DYNLRB1 |
| Gene ID (NCBI) | 83658 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NP97 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
The DYNLRB1 Polyclonal antibody (Cat# 15049-1-AP) has 3 total citations published in Experimental Molecular Medicine and Molecular Cells. The cited studies focus on the interaction between N-acetyl-D-glucosamine kinase and dynein light-chain roadblock type 1 (DYNLRB1) at Golgi outposts in neuronal dendritic branch points, its role in promoting axonal growth of developing neurons, and its involvement in regulating cell division through the dynein-Lis1-NudE1 complex. The associated research fields are neuroscience/neurobiology and cell biology.
| Species | Application | Title |
|---|---|---|
Exp Mol Med N-acetyl-D-glucosamine kinase interacts with dynein light-chain roadblock type 1 at Golgi outposts in neuronal dendritic branch points. | ||
Mol Cells N-Acetyl-D-Glucosamine Kinase Interacts with Dynein-Lis1-NudE1 Complex and Regulates Cell Division. | ||
Mol Cells N-Acetyl-D-Glucosamine Kinase Promotes the Axonal Growth of Developing Neurons. |
