Published Applications
| IF | See 3 publications below | 
Product Information
15049-1-AP targets DYNLRB1 in IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag7032 Product name: Recombinant human DYNLRB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-96 aa of BC002481 Sequence: MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE Predict reactive species | 
                                    
| Full Name | dynein, light chain, roadblock-type 1 | 
| Calculated Molecular Weight | 11 kDa | 
| GenBank Accession Number | BC002481 | 
| Gene Symbol | DYNLRB1 | 
| Gene ID (NCBI) | 83658 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9NP97 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Publications
| Species | Application | Title | 
|---|---|---|
Mol Cells N-Acetyl-D-Glucosamine Kinase Interacts with Dynein-Lis1-NudE1 Complex and Regulates Cell Division. | ||
Exp Mol Med N-acetyl-D-glucosamine kinase interacts with dynein light-chain roadblock type 1 at Golgi outposts in neuronal dendritic branch points. | ||
Mol Cells N-Acetyl-D-Glucosamine Kinase Promotes the Axonal Growth of Developing Neurons. | 
