Tested Applications
Positive WB detected in | human brain tissue, human heart tissue, Sp2/0 cells |
Positive IP detected in | mouse skeletal muscle tissue |
Positive IHC detected in | human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse testis tissue |
Positive IF/ICC detected in | SH-SY5Y cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:300-1:600 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 7 publications below |
IHC | See 3 publications below |
IF | See 4 publications below |
Product Information
11954-1-AP targets DYNLT1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2557 Product name: Recombinant human DYNLT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC029412 Sequence: MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI Predict reactive species |
Full Name | dynein, light chain, Tctex-type 1 |
Calculated Molecular Weight | 113 aa, 12 kDa |
Observed Molecular Weight | 12 kDa |
GenBank Accession Number | BC029412 |
Gene Symbol | DYNLT1 |
Gene ID (NCBI) | 6993 |
RRID | AB_2230661 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P63172 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DYNLT (or Tctex-1) was originally described as a light chain component of the dynein motor complex. Tctex-1 also has several dynein-independent functions, including roles in G protein signaling activation and neuronal growth. Tctex-1 is selectively enriched in proliferating neural progenitors of both embryonic and adult brains. Genetic knockdown of Tctex-1 in radial precursors promoted neurogenesis, indicating its implication in regulation of cortical neurogenesis. (Pubmed: 19448628)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for DYNLT1 antibody 11954-1-AP | Download protocol |
IHC protocol for DYNLT1 antibody 11954-1-AP | Download protocol |
IF protocol for DYNLT1 antibody 11954-1-AP | Download protocol |
IP protocol for DYNLT1 antibody 11954-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nanomicro Lett Molecular Mechanisms of Intracellular Delivery of Nanoparticles Monitored by an Enzyme-Induced Proximity Labeling | ||
Nat Neurosci Lfc and Tctex-1 regulate the genesis of neurons from cortical precursor cells.
| ||
Cell Res Dlic1 deficiency impairs ciliogenesis of photoreceptors by destabilizing dynein. | ||
J Cell Biol Ndel1 suppresses ciliogenesis in proliferating cells by regulating the trichoplein-Aurora A pathway.
| ||
Cancers (Basel) Dynein Light Chain Protein Tctex1: A Novel Prognostic Marker and Molecular Mediator in Glioblastoma. | ||
Biochem Pharmacol Cannabinoid receptor-2 expression modulates Gβ1γ2 protein interaction with the activator of G protein signalling 2/dynein light chain protein Tctex-1. |