Anti-Human DcR1/TNFRSF10C Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of human peripheral blood leukocytes using 98617-3-RR (same clone as 98617-3-PBS)

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human DcR1/TNFRSF10C Rabbit RecAb (98617-3-RR, Clone: 251096B10) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9), and PE-conjugated Goat Anti-Rabbit IgG. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98617-3-PBS in a different storage buffer formulation.

• 

  FC experiment of human peripheral blood leukocytes using 98617-3-RR (same clone as 98617-3-PBS)

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human DcR1/TNFRSF10C Rabbit RecAb (98617-3-RR, Clone: 251096B10) (red) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-conjugated Goat Anti-Rabbit IgG. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98617-3-PBS in a different storage buffer formulation.

• 

  Affinity of 98617-3-RR

  Biolayer interferometry (BLI) kinetic assays of 98617-3-RR against Human DcR1/TNFRSF10C were performed. The affinity constant is 7.21 nM.

DcR1/TNFRSF10C Uni-rAb^® Recombinant Antibody for FC

Cat No. 98617-3-PBS

Clone No.251096B10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

DcR1, Antagonist decoy receptor for TRAIL/Apo-2L, CD263, Decoy receptor 1, LIT

---

Product Information

98617-3-PBS targets DcR1/TNFRSF10C in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4677

  Product name: Recombinant Human DcR1/TNFRSF10C protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 26-235 aa of NM_003841.5

  Sequence: ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTP

• Full Name: tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
• Calculated Molecular Weight: 27 kDa
• GenBank Accession Number: NM_003841.5
• Gene Symbol: DcR1
• Gene ID (NCBI): 8794
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14798
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Decoy receptor 1 (DcR1), also known as TNFRSF10C, CD263, TRAIL-R3, or TRID, is a member of the TNF-receptor superfamily. DcR1 is a receptor for the cytotoxic ligand TRAIL. In contrast to DR4/TRAIL-R1 and DR5/TRAIL-R2, DcR1 is a glycosylphosphatidylinositol (GPI)-linked membrane molecule that lacks a cytoplasmic region, including the death domain (PMID: 9314565; 9242611). DcR1 is not capable of inducing apoptosis and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis (PMID: 9242610).