Dermatopontin Monoclonal antibody, PBS Only

• 

  WB analysis of rat skin using 66348-1-Ig (same clone as 66348-1-PBS)

  rat skin tissue were subjected to SDS PAGE followed by western blot with 66348-1-Ig (Dermatopontin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66348-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 66348-1-Ig (same clone as 66348-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 66348-1-Ig (Dermatopontin antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66348-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 66348-1-Ig (same clone as 66348-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using Dermatopontin antibody (66348-1-Ig, Clone: 4B1A12 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66348-1-PBS in a different storage buffer formulation.

Dermatopontin Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 66348-1-PBS

Clone No.4B1A12

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

dermatopontin, DPT, TRAMP

---

Product Information

66348-1-PBS targets Dermatopontin in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6200

  Product name: Recombinant human DPT protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-201 aa of BC033736

  Sequence: MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV

• Full Name: dermatopontin
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC033736
• Gene Symbol: DPT/TRAMP
• Gene ID (NCBI): 1805
• RRID: AB_2881728
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q07507
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DPT (dermatopontin) is an extracellular matrix protein belonging to the dermatopontin family. Skin appears to be the richest source of dermatopontin, comprising about 15 mg/kg of the wet weight. Expression of dermatopontin is not limited to connective tissue, as investigations show that dermatopontin mRNA is expressed in cultured fibroblasts, muscle, heart, pancreas, and lung. Dermatopontin comprises a considerable proportion of the noncollagenous extracellular matrix proteins. It is involved in promotion of cellular adhesion, extracellular matrix assembly, wound healing, and positive modification of the inhibition activity of TGF-beta1.