Dermatopontin Monoclonal antibody

• 

  WB analysis of rat skin using 66348-1-Ig

  rat skin tissue were subjected to SDS PAGE followed by western blot with 66348-1-Ig (Dermatopontin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 66348-1-Ig

  human testis tissue were subjected to SDS PAGE followed by western blot with 66348-1-Ig (Dermatopontin antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of SH-SY5Y using 66348-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using Dermatopontin antibody (66348-1-Ig, Clone: 4B1A12 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

Dermatopontin Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 66348-1-Ig

Clone No.4B1A12

Publications(1)

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat

Applications

WB, IF/ICC, ELISA

Synonyms

dermatopontin, DPT, TRAMP

---

Tested Applications

• Positive WB detected in: rat skin tissue, human testis tissue
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

66348-1-Ig targets Dermatopontin in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6200

  Product name: Recombinant human DPT protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-201 aa of BC033736

  Sequence: MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV

• Full Name: dermatopontin
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC033736
• Gene Symbol: DPT/TRAMP
• Gene ID (NCBI): 1805
• RRID: AB_2881728
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q07507
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DPT (dermatopontin) is an extracellular matrix protein belonging to the dermatopontin family. Skin appears to be the richest source of dermatopontin, comprising about 15 mg/kg of the wet weight. Expression of dermatopontin is not limited to connective tissue, as investigations show that dermatopontin mRNA is expressed in cultured fibroblasts, muscle, heart, pancreas, and lung. Dermatopontin comprises a considerable proportion of the noncollagenous extracellular matrix proteins. It is involved in promotion of cellular adhesion, extracellular matrix assembly, wound healing, and positive modification of the inhibition activity of TGF-beta1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	J Cancer Res Clin Oncol; Downregulation of dermatopontin in cholangiocarcinoma cells suppresses CCL19 secretion of macrophages and immune infiltration; Authors - Peng Xu