Desmin Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Desmin Recombinant monoclonal antibody (82748-2-RR)

• 

  IHC staining of human colon using 82748-2-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 82748-2-RR (Desmin antibody) at dilution of 1:3000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 82748-2-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 82748-2-RR (Desmin antibody) at dilution of 1:3000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Desmin Uni-rAb^® Recombinant Antibody for IHC, ELISA

Cat No. 82748-2-RR

Clone No.5K5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

DES

---

Tested Applications

• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:1500-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82748-2-RR targets Desmin in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9742

  Product name: Recombinant human Desmin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 121-470 aa of BC032116

  Sequence: NYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

• Full Name: desmin
• Calculated Molecular Weight: 470 aa, 54 kDa
• GenBank Accession Number: BC032116
• Gene Symbol: Desmin
• Gene ID (NCBI): 1674
• RRID: AB_3743422
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P17661
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Desmin is the main intermediate filament protein in skeletal and cardiac muscle cells and is essential for both the structural integrity and the survival of muscle cells. As an abundant muscle-specific protein, desmin has been widely used as a marker of muscle derived tumors. Anti-desmin is also valuable in the differential diagnosis of tumors of uncertain origin.