EB3 Polyclonal antibody, PBS Only

• 

  WB analysis using 23974-1-AP (same clone as 23974-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23974-1-AP (EB3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 23974-1-AP (same clone as 23974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 23974-1-AP (EB3 antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 23974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 23974-1-AP (same clone as 23974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 23974-1-AP (EB3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 23974-1-AP (same clone as 23974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 23974-1-AP (EB3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 23974-1-AP (same clone as 23974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 23974-1-AP (EB3 antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 23974-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 23974-1-AP (same clone as 23974-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using EB3 antibody (23974-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 23974-1-PBS in a different storage buffer formulation.

EB3 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 23974-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

End binding protein 3, End-binding protein 3, MAPRE3, Microtubule-associated protein RP/EB family member 3

---

Product Information

23974-1-PBS targets EB3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21148

  Product name: Recombinant human MAPRE3 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-281 aa of BC011557

  Sequence: MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY

• Full Name: microtubule-associated protein, RP/EB family, member 3
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 30-36 kDa
• GenBank Accession Number: BC011557
• Gene Symbol: EB3
• Gene ID (NCBI): 22924
• RRID: AB_2879385
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9UPY8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.