EB3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EB3 Polyclonal antibody (23974-1-AP)

EB3 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 23974-1-AP

Publications(4)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

End binding protein 3, End-binding protein 3, MAPRE3, Microtubule-associated protein RP/EB family member 3

• 

  WB analysis using 23974-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23974-1-AP (EB3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 23974-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 23974-1-AP (EB3 antibody at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 23974-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 23974-1-AP (EB3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 23974-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 23974-1-AP (EB3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 23974-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 23974-1-AP (EB3 antibody at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse testis using 23974-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using EB3 antibody (23974-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, fetal human brain tissue, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue, human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23974-1-AP targets EB3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21148

  Product name: Recombinant human MAPRE3 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-281 aa of BC011557

  Sequence: MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY

• Full Name: microtubule-associated protein, RP/EB family, member 3
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 30-36 kDa
• GenBank Accession Number: BC011557
• Gene Symbol: EB3
• Gene ID (NCBI): 22924
• RRID: AB_2879385
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9UPY8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Nat Commun; Microtubule asters anchored by FSD1 control axoneme assembly and ciliogenesis.; Authors - Hai-Qing Tu
mouse	WB	Cell Tissue Res; Filamin-A-interacting protein 1 (FILIP1) is a dual compartment protein linking myofibrils and microtubules during myogenic differentiation and upon mechanical stress; Authors - Valentina Grande
rat	IF	Neural Regen Res; The interaction between KIF21A and KANK1 regulates dendritic morphology and synapse plasticity in neurons; Authors - Shi-Yan Sun
mouse	WB	Nat Commun; DNA replication fork speed acts as a pacer in cortical neurogenesis.; Authors - Jianhong Wang

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Alice (Verified Customer) (02-18-2026)

It worked well for a western blot. I had two bands- one which I belive to be EB3 bound to microtubules, and one which was free EB3.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Sheep atrial tissue