EDEM3 Polyclonal antibody

EDEM3 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 27310-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

Synonyms

ER degradation-enhancing alpha-mannosidase-like protein 3, EC:3.2.1.113, C1orf22, Alpha-1,2-mannosidase EDEM3

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllWBIPIHC

WB analysis of 3T3-L1 using 27310-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 27310-1-AP (EDEM3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of HEK-293 using 27310-1-AP
IP result of anti-EDEM3 (IP:27310-1-AP, 4ug; Detection:27310-1-AP 1:300) with HEK-293 cells lysate 2600ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 27310-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27310-1-AP (EDEM3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Positive WB detected in	3T3-L1 cells, HEK-293 cell
Positive IP detected in	HEK-293 cells
Positive IHC detected in	human stomach cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Application	Dilution
Western Blot (WB)	WB : 1:500-1:3000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

27310-1-AP targets EDEM3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag26123 Product name: Recombinant human EDEM3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC016464 Sequence: DNAASISPSEQTSNPTENHETTNLNGECTDLDNQLQEQSETEEDSNPNVSWGKKVQPIDSILADWNEDIEAFEMMEKDEL Predict reactive species
Full Name	ER degradation enhancer, mannosidase alpha-like 3
Calculated Molecular Weight	105 kDa
Observed Molecular Weight	100-110 kDa
GenBank Accession Number	BC016464
Gene Symbol	EDEM3
Gene ID (NCBI)	80267
RRID	AB_2880839
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9BZQ6
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Product Specific Protocols
IHC protocol for EDEM3 antibody 27310-1-AP	Download protocol
IP protocol for EDEM3 antibody 27310-1-AP	Download protocol
WB protocol for EDEM3 antibody 27310-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Species	Application	Title
		Cell Biosci CALR-dependent endoplasmic reticulum N-glycoprotein maturation promotes Japanese encephalitis virus entry and replication. Authors - Yonghui Zhang View Article