Tested Applications
| Positive WB detected in | HEK-293 cells, L02 cells, 3T3-L1 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27310-1-AP targets EDEM3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26123 Product name: Recombinant human EDEM3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC016464 Sequence: DNAASISPSEQTSNPTENHETTNLNGECTDLDNQLQEQSETEEDSNPNVSWGKKVQPIDSILADWNEDIEAFEMMEKDEL Predict reactive species |
| Full Name | ER degradation enhancer, mannosidase alpha-like 3 |
| Calculated Molecular Weight | 105 kDa |
| Observed Molecular Weight | 100-110 kDa |
| GenBank Accession Number | BC016464 |
| Gene Symbol | EDEM3 |
| Gene ID (NCBI) | 80267 |
| RRID | AB_2880839 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BZQ6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for EDEM3 antibody 27310-1-AP | Download protocol |
| IP protocol for EDEM3 antibody 27310-1-AP | Download protocol |
| WB protocol for EDEM3 antibody 27310-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The EDEM3 Polyclonal antibody (Catalog No. 27310-1-AP) has 1 total citation. It appears in the journal Cell Biosci (2026). The associated research field involves endoplasmic reticulum N-glycoprotein maturation and its role in promoting Japanese encephalitis virus entry and replication, linking EDEM3 to calnexin/calreticulin-dependent glycoprotein processing and viral infection mechanisms.
| Species | Application | Title |
|---|---|---|
Cell Biosci CALR-dependent endoplasmic reticulum N-glycoprotein maturation promotes Japanese encephalitis virus entry and replication. |
Reviews
What customers say
The single review reports the antibody works well for Western Blot, producing a single clean band at a 1:1000 dilution in LNCaP and CWR22Rv1 prostate cancer cell lines. The reviewer rated it 5 stars, indicating strong performance and specificity for the intended application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Emma (Verified Customer) (03-15-2022) | Works well (single band) by WB in LNCaP and CWR22Rv1 cells @ 1:1000
|
