Tested Applications
| Positive WB detected in | 3T3-L1 cells, HEK-293 cell |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27310-1-AP targets EDEM3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26123 Product name: Recombinant human EDEM3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC016464 Sequence: DNAASISPSEQTSNPTENHETTNLNGECTDLDNQLQEQSETEEDSNPNVSWGKKVQPIDSILADWNEDIEAFEMMEKDEL Predict reactive species |
| Full Name | ER degradation enhancer, mannosidase alpha-like 3 |
| Calculated Molecular Weight | 105 kDa |
| Observed Molecular Weight | 100-110 kDa |
| GenBank Accession Number | BC016464 |
| Gene Symbol | EDEM3 |
| Gene ID (NCBI) | 80267 |
| RRID | AB_2880839 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BZQ6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for EDEM3 antibody 27310-1-AP | Download protocol |
| IP protocol for EDEM3 antibody 27310-1-AP | Download protocol |
| WB protocol for EDEM3 antibody 27310-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Emma (Verified Customer) (03-15-2022) | Works well (single band) by WB in LNCaP and CWR22Rv1 cells @ 1:1000
|





