EFHD1 Polyclonal antibody, PBS Only

• 

  IHC staining of human kidney using 19854-1-AP (same clone as 19854-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 19854-1-AP (EFHD1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 19854-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 19854-1-AP (same clone as 19854-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 19854-1-AP (EFHD1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 19854-1-PBS in a different storage buffer formulation.

EFHD1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 19854-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

19854-1-PBS targets EFHD1 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13926

  Product name: Recombinant human EFHD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-113 aa of BC002449

  Sequence: MASEELACKLERRLRREEAEESGPQLAPLGAPAPEPKPEPEPPARAPTASADAELSAQLSRRLDINEGAARPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLM

• Full Name: EF-hand domain family, member D1
• Calculated Molecular Weight: 239 aa, 27 kDa
• GenBank Accession Number: BC002449
• Gene Symbol: EFHD1
• Gene ID (NCBI): 80303
• RRID: AB_2878615
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUP0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.