Product Information
12181-1-AP targets EFHD2 in ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2826 Product name: Recombinant human EFHD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC013648 Sequence: MPWDHGQGRLWGSETPLLSTPSQNTLRVSGLWREWGGRKNWHLPREGDERFALILREASEKCFKCVCMRQAVGSGGLSSPLPPSFPK Predict reactive species |
Full Name | EF-hand domain family, member D2 |
Calculated Molecular Weight | 240 aa, 27 kDa |
GenBank Accession Number | BC013648 |
Gene Symbol | EFHD2 |
Gene ID (NCBI) | 79180 |
RRID | AB_2877833 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96C19 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
EFHD2, also known as Swiprosin-1, is a cytoskeletal protein that has been shown to influence dimerization in a Ca2+-dependent manner. The expression of EFHD2 was first observed in CD8+ T cells. This protein has also been observed in B-cells, lung, brain, and spleen.