EFHD2 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

EFHD2 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83264-1-PBS
Clone No.240185C3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

EF-hand domain-containing protein D2, Swiprosin 1, Swiprosin-1, SWS1

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83264-1-PBS targets EFHD2 as part of a matched antibody pair:

MP00269-1: 83264-1-PBS capture and 83264-4-PBS detection (validated in Cytometric bead array)

MP00269-2: 83264-2-PBS capture and 83264-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35084

Product name: Recombinant human EFHD2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-80 aa of BC023611

Sequence: ATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVF

Predict reactive species
Full Name EF-hand domain family, member D2
Calculated Molecular Weight27 kDa
GenBank Accession NumberBC023611
Gene Symbol EFHD2
Gene ID (NCBI) 79180
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96C19
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EFHD2, also known as Swiprosin-1, is a cytoskeletal protein that has been shown to influence dimerization in a Ca2+-dependent manner. The expression of EFHD2 was first observed in CD8+ T cells. This protein has also been observed in B-cells, lung, brain, and spleen.

Loading...
||
New chat Able
正在加载,请稍候...