EGF Polyclonal antibody

• 

EGF Polyclonal Antibody for ELISA

Cat No. 22209-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

Pro-epidermal growth factor

---

Published Applications

• WB: See 2 publications below

Product Information

22209-1-AP targets EGF in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17529

  Product name: Recombinant human EGF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 971-1023 aa of BC093731

  Sequence: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

• Full Name: epidermal growth factor (beta-urogastrone)
• Calculated Molecular Weight: 1207 aa, 134 kDa
• GenBank Accession Number: BC093731
• Gene Symbol: EGF
• Gene ID (NCBI): 1950
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01133
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Neuro Oncol; Role of glycosyltransferase PomGnT1 in glioblastoma progression.; Authors - Jin Lan
mouse	WB	PLoS One; Smart thermosensitive poloxamer hydrogels loaded with Nr-CWs for the treatment of diabetic wounds; Authors - Jian Wang