EGR1 Polyclonal antibody

EGR1 Polyclonal Antibody for WB, ELISA
Cat No. 31098-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

AT225, early growth response 1, EGR 1, EGR1, G0S30, KROX 24, KROX24, NGFI A, TIS8, Transcription factor ETR103, Transcription factor Zif268, ZIF 268, Zinc finger protein 225, Zinc finger protein Krox 24, ZNF225

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, Jurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

31098-1-AP targets EGR1 in WB, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag33440

Product name: Recombinant human EGR1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 414-543 aa of BC073983

Sequence: HTKIHLRQKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC*

Predict reactive species
Full Name early growth response 1
Calculated Molecular Weight 543 aa, 58 kDa
Observed Molecular Weight 70-80 kDa
GenBank Accession NumberBC073983
Gene Symbol EGR1
Gene ID (NCBI) 1958
RRIDAB_3669855
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDP18146
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EGR1, also named as Early growth response protein 1, is a 543 amino acid protein, which belongs to the EGR C2H2-type zinc-finger protein family. EGR1 as a transcriptional regulator recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes and binds double-stranded target DNA, irrespective of the cytosine methylation status. EGR1 regulates the transcription of numerous target genes, and thereby plays an important role in regulating the response to growth factors, DNA damage, and ischemia. EGR1 activates expression of p53/TP53 and TGFB1, and thereby helps prevent tumor formation and plays a role in the regulation of cell survival, proliferation and cell death. Egr1 is suggested to be a 55-kDa protein according to the translation of its coding sequence. Analysis of cytoplasmic and nuclear fractions of normal and irradiated native CNS tissue by Western blotting revealed a 110-kDa band for Egr1 localized in the cytoplasm and a 75-kDa version for the nuclear Egr1(PMID: 17497096)

Protocols

Product Specific Protocols
WB protocol for EGR1 antibody 31098-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...