EHBP1L1 Polyclonal antibody

• 

  WB analysis using 29383-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29383-1-AP (EHBP1L1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat testis using 29383-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 29383-1-AP (EHBP1L1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 29383-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 29383-1-AP (EHBP1L1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

EHBP1L1 Polyclonal Antibody for WB, ELISA

Cat No. 29383-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

EHBP1L 1

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29383-1-AP targets EHBP1L1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29796

  Product name: Recombinant human EHBP1L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 549-747 aa of NM_001099409

  Sequence: AQGAISRGLGGWEAEAGGSGDLETETEVVGLEVLGTQEKEVEGSGFPETRTLEIEILGALEKEAARSRVLESEVAGTAQCEGLETQETEVGVIETPGTETEVLGTQKTEAGGSGVLQTRTTIAETEVLVTQEISGDLGPLKIEDTIQSEMLGTQETEVEASRVPESEAEGTEAKILGTQEITARDSGVREIEAEIAESD

• Full Name: EH domain binding protein 1-like 1
• Calculated Molecular Weight: 162 kDa
• Observed Molecular Weight: 162 kDa
• GenBank Accession Number: NM_001099409
• Gene Symbol: EHBP1L1
• Gene ID (NCBI): 254102
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N3D4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EHBP1L1 is an adapter protein localized on recycling endosomes. It regulates apical-directed transport in polarized epithelial cells. Additionally, EHBP1L1 is crucial for erythroblast enucleation by promoting nuclear polarization in coordination with Rab10, Bin1, and dynamin. It also maintains the proper morphology and structural stability of erythrocytes.