EHD3 Polyclonal antibody

• 

  WB analysis using 25320-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25320-1-AP (EHD3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human peripheral blood platelets using 25320-1-AP

  human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 25320-1-AP (EHD3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 25320-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 25320-1-AP (EHD3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 25320-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 25320-1-AP (EHD3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse lung using 25320-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 25320-1-AP (EHD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 25320-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 25320-1-AP (EHD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 25320-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 25320-1-AP (EHD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 25320-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 25320-1-AP (EHD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 25320-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25320-1-AP (EHD3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 25320-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25320-1-AP (EHD3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 25320-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25320-1-AP (EHD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 25320-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25320-1-AP (EHD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

EHD3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25320-1-AP

Publications(6)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IF, IHC, ELISA

Synonyms

EH domain containing 3, EH domain containing protein 3, EHD2, EHD3, PAST homolog 3, PAST3

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human peripheral blood platelets, rat brain tissue, mouse kidney tissue
• Positive IHC detected in: mouse lung tissue, human brain tissue, mouse brain tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 4 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

25320-1-AP targets EHD3 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18216

  Product name: Recombinant human EHD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 353-422 aa of BC156996

  Sequence: FPNLKRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPIQMVKGGAFEGTLHGPF

• Full Name: EH-domain containing 3
• Calculated Molecular Weight: 535 aa, 61 kDa
• Observed Molecular Weight: 61 kDa
• GenBank Accession Number: BC156996
• Gene Symbol: EHD3
• Gene ID (NCBI): 30845
• RRID: AB_2880029
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZN3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
zebrafish	WB	Nat Cell Biol; Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.; Authors - Quanlong Lu ; KD Validated
mouse, zebrafish	WB,IF	Nat Cell Biol; Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.; Authors - Quanlong Lu ; KD Validated
human	WB	EBioMedicine; EHD1 impairs decidualization by regulating the Wnt4/β-catenin signaling pathway in recurrent implantation failure.; Authors - Quan Zhou
human	WB	EMBO J; Insufficiency of ciliary cholesterol in hereditary Zellweger syndrome.; Authors - Tatsuo Miyamoto ; KO Validated
rat	IHC	Int J Mol Sci; Proteomic Analysis of Dysfunctional Liver Sinusoidal Endothelial Cells Reveals Substantial Differences in Most Common Experimental Models of Chronic Liver Diseases; Authors - Mar Gil
mouse	IHC	Am J Physiol Renal Physiol; Unique miRNome and transcriptome profiles underlie microvascular heterogeneity in mouse kidney; Authors - Matthijs Luxen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Kyosuke (Verified Customer) (06-12-2019)

I works well on HUVECs for Western blot.

• Applications: Western Blot,
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: HUVECs