Tested Applications
Positive WB detected in | mouse brain tissue, human peripheral blood platelets, rat brain tissue, mouse kidney tissue |
Positive IHC detected in | mouse lung tissue, human brain tissue, mouse brain tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:8000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 4 publications below |
IHC | See 2 publications below |
IF | See 1 publications below |
Product Information
25320-1-AP targets EHD3 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, zebrafish |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18216 Product name: Recombinant human EHD3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 353-422 aa of BC156996 Sequence: FPNLKRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPIQMVKGGAFEGTLHGPF Predict reactive species |
Full Name | EH-domain containing 3 |
Calculated Molecular Weight | 535 aa, 61 kDa |
Observed Molecular Weight | 61 kDa |
GenBank Accession Number | BC156996 |
Gene Symbol | EHD3 |
Gene ID (NCBI) | 30845 |
RRID | AB_2880029 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NZN3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for EHD3 antibody 25320-1-AP | Download protocol |
IHC protocol for EHD3 antibody 25320-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Cell Biol Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.
| ||
Nat Cell Biol Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.
| ||
EBioMedicine EHD1 impairs decidualization by regulating the Wnt4/β-catenin signaling pathway in recurrent implantation failure. | ||
EMBO J Insufficiency of ciliary cholesterol in hereditary Zellweger syndrome.
| ||
Int J Mol Sci Proteomic Analysis of Dysfunctional Liver Sinusoidal Endothelial Cells Reveals Substantial Differences in Most Common Experimental Models of Chronic Liver Diseases | ||
Am J Physiol Renal Physiol Unique miRNome and transcriptome profiles underlie microvascular heterogeneity in mouse kidney |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Kyosuke (Verified Customer) (06-12-2019) | I works well on HUVECs for Western blot.
|