EI24 Polyclonal antibody

• 

  WB analysis using 20456-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20456-1-AP (EI24 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 20456-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 20456-1-AP (EI24 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 20456-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 20456-1-AP (EI24 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

EI24 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20456-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

etoposide induced 2.4 mRNA, Etoposide-induced protein 2.4 homolog, p53 induced gene 8 protein, p53-induced factor Ei24, p53-induced gene 8 protein

---

Tested Applications

• Positive WB detected in: K-562 cells, HT-1080 cells, HeLa cells, L02 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 3 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

20456-1-AP targets EI24 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14169

  Product name: Recombinant human EI24 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 267-340 aa of BC002390

  Sequence: SILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH

• Full Name: etoposide induced 2.4 mRNA
• Calculated Molecular Weight: 340 aa, 39 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC002390
• Gene Symbol: EI24
• Gene ID (NCBI): 9538
• RRID: AB_10858326
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14681
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ei24 is an ER-localized protein originally identified as a p53-induced proapoptotic gene in etoposide-treated NIH3T3 cells. It has been shown to be able to bind to the antiapoptotic protein Bcl-2 (PMID: 15781622), play a role in autophagy (PMID: 23074225), and induce proliferate arrest/apoptosis (PMID: 10594026). Ei24 can bind specifically to IMPβ1 and IMPα2 to impede their normal role in nuclear import (PMID: 24821838).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IHC,IF	Int J Biochem Cell Biol; Etoposide-induced protein 2.4 ameliorates high glucose-induced epithelial-mesenchymal transition by activating adenosine monophosphate-activated protein kinase pathway in renal tubular cells; Authors - Fan Li ; KD Validated
human	WB	BMC Cancer; Circular RNA hsa_circ_0043278 inhibits breast cancer progression via the miR-455-3p/EI24 signalling pathway; Authors - Yue Shi ; KD Validated
human	WB,IHC	Expert Rev Mol Diagn; Prognostic role and immune infiltration characteristics of EI24 in multiple cancer types; Authors - Wanli Yang