Tested Applications
Positive WB detected in | K-562 cells, HT-1080 cells, HeLa cells, L02 cells |
Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 3 publications below |
IHC | See 2 publications below |
IF | See 1 publications below |
Product Information
20456-1-AP targets EI24 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14169 Product name: Recombinant human EI24 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 267-340 aa of BC002390 Sequence: SILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH Predict reactive species |
Full Name | etoposide induced 2.4 mRNA |
Calculated Molecular Weight | 340 aa, 39 kDa |
Observed Molecular Weight | 40-45 kDa |
GenBank Accession Number | BC002390 |
Gene Symbol | EI24 |
Gene ID (NCBI) | 9538 |
RRID | AB_10858326 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O14681 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ei24 is an ER-localized protein originally identified as a p53-induced proapoptotic gene in etoposide-treated NIH3T3 cells. It has been shown to be able to bind to the antiapoptotic protein Bcl-2 (PMID: 15781622), play a role in autophagy (PMID: 23074225), and induce proliferate arrest/apoptosis (PMID: 10594026). Ei24 can bind specifically to IMPβ1 and IMPα2 to impede their normal role in nuclear import (PMID: 24821838).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for EI24 antibody 20456-1-AP | Download protocol |
IHC protocol for EI24 antibody 20456-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Int J Biochem Cell Biol Etoposide-induced protein 2.4 ameliorates high glucose-induced epithelial-mesenchymal transition by activating adenosine monophosphate-activated protein kinase pathway in renal tubular cells
| ||
BMC Cancer Circular RNA hsa_circ_0043278 inhibits breast cancer progression via the miR-455-3p/EI24 signalling pathway
| ||
Expert Rev Mol Diagn Prognostic role and immune infiltration characteristics of EI24 in multiple cancer types |