Product Information
20456-1-PBS targets EI24 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14169 Product name: Recombinant human EI24 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 267-340 aa of BC002390 Sequence: SILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH Predict reactive species |
Full Name | etoposide induced 2.4 mRNA |
Calculated Molecular Weight | 340 aa, 39 kDa |
Observed Molecular Weight | 40-45 kDa |
GenBank Accession Number | BC002390 |
Gene Symbol | EI24 |
Gene ID (NCBI) | 9538 |
RRID | AB_10858326 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O14681 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Ei24 is an ER-localized protein originally identified as a p53-induced proapoptotic gene in etoposide-treated NIH3T3 cells. It has been shown to be able to bind to the antiapoptotic protein Bcl-2 (PMID: 15781622), play a role in autophagy (PMID: 23074225), and induce proliferate arrest/apoptosis (PMID: 10594026). Ei24 can bind specifically to IMPβ1 and IMPα2 to impede their normal role in nuclear import (PMID: 24821838).