Tested Applications
| Positive WB detected in | Jurkat cells, HeLa cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 1 publications below |
Product Information
15276-1-AP targets EIF1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, monkey, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7394 Product name: Recombinant human EIF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC005118 Sequence: MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF Predict reactive species |
| Full Name | eukaryotic translation initiation factor 1 |
| Calculated Molecular Weight | 13 kDa |
| GenBank Accession Number | BC005118 |
| Gene Symbol | EIF1 |
| Gene ID (NCBI) | 10209 |
| RRID | AB_2878121 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P41567 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
It is a necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA. Molecular weight is 13kd.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for EIF1 antibody 15276-1-AP | Download protocol |
| IP protocol for EIF1 antibody 15276-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Hematol Oncol METTL16 promotes liver cancer stem cell self-renewal via controlling ribosome biogenesis and mRNA translation | ||
Front Immunol A novel cuproptosis pattern and tumor immune microenvironment characterization in urothelial carcinoma of the bladder | ||
PLoS Pathog SARS-CoV-2 Nsp1 cooperates with initiation factors EIF1 and 1A to selectively enhance translation of viral RNA | ||
Adv Sci (Weinh) DDX3 Regulates the Cap-Independent Translation of the Japanese Encephalitis Virus via Its Interactions with PABP1 and the Untranslated Regions of the Viral Genome | ||









