EIF2B3 Polyclonal antibody, PBS Only

• 

  WB analysis using 11296-2-AP (same clone as 11296-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11296-2-AP (EIF2B3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11296-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 11296-2-AP (same clone as 11296-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 11296-2-AP (EIF2B3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11296-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 11296-2-AP (same clone as 11296-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 11296-2-AP (EIF2B3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11296-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 11296-2-AP (same clone as 11296-2-PBS)

  Immunofluorescent analysis of HeLa cells using 11296-2-AP (EIF2B3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11296-2-PBS in a different storage buffer formulation.

EIF2B3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11296-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

11296-2-PBS targets EIF2B3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1809

  Product name: Recombinant human EIF2B3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 15-232 aa of BC018728

  Sequence: GSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGPETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEG

• Full Name: eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa
• Calculated Molecular Weight: 44 kDa, 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC018728
• Gene Symbol: EIF2B3
• Gene ID (NCBI): 8891
• RRID: AB_2096142
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NR50
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.