EIF2B3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EIF2B3 Polyclonal antibody (11296-2-AP)

EIF2B3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11296-2-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Translation initiation factor eIF2B subunit gamma, EIF2Bgamma, eIF2B GDP-GTP exchange factor subunit gamma, EIF 2B

• 

  WB analysis using 11296-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11296-2-AP (EIF2B3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 11296-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 11296-2-AP (EIF2B3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 11296-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 11296-2-AP (EIF2B3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 11296-2-AP

  Immunofluorescent analysis of HeLa cells using 11296-2-AP (EIF2B3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EIF2B3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, PC-3 cells
• Positive IHC detected in: mouse colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11296-2-AP targets EIF2B3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1809

  Product name: Recombinant human EIF2B3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 15-232 aa of BC018728

  Sequence: GSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGPETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEG

• Full Name: eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa
• Calculated Molecular Weight: 44 kDa, 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC018728
• Gene Symbol: EIF2B3
• Gene ID (NCBI): 8891
• RRID: AB_2096142
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NR50
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The EIF2B3 Polyclonal antibody (Cat# 11296-2-AP) has 2 citations. They appear in Molecular Biology of the Cell and eLife. The research fields cover the integrated stress response and eIF2B subunit localization, as well as Vanishing White Matter Disease involving eIF2B mutant complex stability and activity. Applications cited include IF and WB in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Mol Biol Cell; Cellular eIF2B subunit localization: implications for the integrated stress response and its control by small molecule drugs.; Authors - Rachel E Hodgson
	WB	Elife; The small molecule ISRIB rescues the stability and activity of Vanishing White Matter Disease eIF2B mutant complexes.; Authors - Yao Liang Wong