Product Information
68463-1-PBS targets EIF2S2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18349 Product name: Recombinant human EIF2S2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-210 aa of BC000461 Sequence: MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVV Predict reactive species |
| Full Name | eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa |
| Calculated Molecular Weight | 38 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC000461 |
| Gene Symbol | EIF2S2 |
| Gene ID (NCBI) | 8894 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P20042 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Eukaryotic translation initiation factor 2 (eIF2) is composed of three subunits, eIF2 alpha, eIF2 beta (EIF2S2), and eIF2 gamma, which are present in equal molar amounts. eIF2 beta plays a central role in the maintenance of what is generally considered a rate-limiting step in mRNA translation. In the early steps of protein synthesis, eIF2 beta binds GTP and Met-tRNA and transfers Met-tRNA to the 40S ribosomal subunit. At the end of the initiation process, GTP bound to eIF2 beta is hydrolyzed to GDP and the eIF2/GDP complex is released from the ribosome. The exchange of GDP bound to eIF2 beta for GTP is a prerequisite to binding Met-tRNA and is mediated by eIF2 beta, which recycles the eIF2 complex for another round of initiation.

