EIF2S2 Monoclonal antibody, PBS Only

EIF2S2 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 68463-1-PBS
Clone No.2H8E1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

2H8E1, eIF 2 beta, EIF2, EIF2B, EIF2beta

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68463-1-PBS targets EIF2S2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18349

Product name: Recombinant human EIF2S2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-210 aa of BC000461

Sequence: MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVV

Predict reactive species
Full Name eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
Calculated Molecular Weight 38 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC000461
Gene Symbol EIF2S2
Gene ID (NCBI) 8894
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP20042
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Eukaryotic translation initiation factor 2 (eIF2) is composed of three subunits, eIF2 alpha, eIF2 beta (EIF2S2), and eIF2 gamma, which are present in equal molar amounts. eIF2 beta plays a central role in the maintenance of what is generally considered a rate-limiting step in mRNA translation. In the early steps of protein synthesis, eIF2 beta binds GTP and Met-tRNA and transfers Met-tRNA to the 40S ribosomal subunit. At the end of the initiation process, GTP bound to eIF2 beta is hydrolyzed to GDP and the eIF2/GDP complex is released from the ribosome. The exchange of GDP bound to eIF2 beta for GTP is a prerequisite to binding Met-tRNA and is mediated by eIF2 beta, which recycles the eIF2 complex for another round of initiation.

Loading...
||
New chat

Able

正在加载,请稍候...