Filter: AllWBIPIHCIF/ICC

WB analysis of mouse thymus using 11162-1-AP (same clone as 11162-1-PBS)
mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11162-1-AP (EIF2S3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11162-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 11162-1-AP (same clone as 11162-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 11162-1-AP (EIF2S3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11162-1-PBS in a different storage buffer formulation.
WB analysis of mouse thymus using 11162-1-AP (same clone as 11162-1-PBS)
mouse thymus tissue were subjected to SDS PAGE followed by western blot with 11162-1-AP (EIF2S3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11162-1-PBS in a different storage buffer formulation.
IP experiment of HeLa using 11162-1-AP (same clone as 11162-1-PBS)
IP result of anti-EIF2S3 (IP:11162-1-AP, 4ug; Detection:11162-1-AP 1:500) with HeLa cells lysate 2800ug. This data was developed using the same antibody clone with 11162-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 11162-1-AP (same clone as 11162-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11162-1-AP (EIF2S3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11162-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 11162-1-AP (same clone as 11162-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11162-1-AP (EIF2S3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11162-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 11162-1-AP (same clone as 11162-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer using 11162-1-AP (EIF2S3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11162-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 11162-1-AP (same clone as 11162-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer using 11162-1-AP (EIF2S3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11162-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 11162-1-AP (same clone as 11162-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis using 11162-1-AP (EIF2S3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11162-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 11162-1-AP (same clone as 11162-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis using 11162-1-AP (EIF2S3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11162-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 11162-1-AP (same clone as 11162-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer using 11162-1-AP (EIF2S3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11162-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 11162-1-AP (same clone as 11162-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer using 11162-1-AP (EIF2S3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11162-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 11162-1-AP (same clone as 11162-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using EIF2S3 antibody (11162-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 11162-1-PBS in a different storage buffer formulation.

EIF2S3 Polyclonal antibody, PBS Only

EIF2S3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 11162-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

EIF2G, EIF2, eIF 2gX, eIF 2gA, eIF 2 gamma X

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

11162-1-PBS targets EIF2S3 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag1650 Product name: Recombinant human EIF2S3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 173-472 aa of BC019906 Sequence: HLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD Predict reactive species
Full Name	eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa
Calculated Molecular Weight	52 kDa
Observed Molecular Weight	52 kDa
GenBank Accession Number	BC019906
Gene Symbol	EIF2S3
Gene ID (NCBI)	1968
RRID	AB_2246331
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P41091
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Interacts with GTP and initiator methionyl-tRNA, translation initiation factor eIF2 forms a ternary complex that binds the 40S ribosome and then scans an mRNA to select the AUG start codon for protein synthesis[PMID: 9736774]. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B. EIF2S3 is the core subunit of the heterotrimeric eIF2 complex.[PMID:23063529]