EIF4A3 Polyclonal antibody

• 

  WB analysis of HeLa using 10463-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10463-1-AP (EIF4A3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10463-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10463-1-AP (EIF4A3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10463-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10463-1-AP (EIF4A3 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10463-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10463-1-AP (EIF4A3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human lung using 10463-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 10463-1-AP (EIF4A3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 10463-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 10463-1-AP (EIF4A3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10463-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10463-1-AP (EIF4A3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 10463-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10463-1-AP (EIF4A3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10463-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10463-1-AP (EIF4A3 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 10463-1-AP

  IP result of anti-EIF4A3 (IP:10463-1-AP, 3ug; Detection:10463-1-AP 1:300) with HEK-293 cells lysate 2800ug.

EIF4A3 Polyclonal Antibody for WB, IP, ELISA

Cat No. 10463-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

Synonyms

DDX48, DEAD box protein 48, eIF 4A III, eIF4A III, EIF4A3, eIF4AIII, hNMP 265, hNMP265, KIAA0111, Nuclear matrix protein 265, NUK 34

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, human lung tissue, mouse liver tissue, Raji cells
• Positive IP detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IP: See 1 publications below

Product Information

10463-1-AP targets EIF4A3 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0733

  Product name: Recombinant human EIF4A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC004386

  Sequence: MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCL

• Full Name: eukaryotic translation initiation factor 4A, isoform 3
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC004386
• Gene Symbol: EIF4A3
• Gene ID (NCBI): 9775
• RRID: AB_2097394
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P38919
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EIF4A3 is a component of the exon junction complex (EJC), which assembles near exon-exon junctions of mRNAs as a result of splicing. EJC proteins involves in postsplicing events, including mRNA export, cytoplasmic localization, and nonsense-mediated decay. Its RNA-dependent ATPase and RNA-helicase activities are induced by CASC3, but abolished in presence of the MAGOH/RBM8A heterodimer, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. Besides, it involved in translational enhancement of spliced mRNAs after formation of the 80S ribosome complex and binds spliced mRNA in sequence-independent manner, 20-24 nucleotides upstream of mRNA exon-exon junctions

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Genes Dev; SMG-8 and SMG-9, two novel subunits of the SMG-1 complex, regulate remodeling of the mRNA surveillance complex during nonsense-mediated mRNA decay.; Authors - Yamashita Akio A
human	WB	Sci Signal; AAA+ proteins RUVBL1 and RUVBL2 coordinate PIKK activity and function in nonsense-mediated mRNA decay.; Authors - Izumi Natsuko N
human	WB	Cell Biol Toxicol; EIF4A3-mediated oncogenic circRNA hsa_circ_0001165 advances esophageal squamous cell carcinoma progression through the miR-381-3p/TNS3 pathway; Authors - Xun Zhang