Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, human lung tissue, mouse liver tissue, Raji cells |
| Positive IP detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IP | See 1 publications below |
Product Information
10463-1-AP targets EIF4A3 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0733 Product name: Recombinant human EIF4A3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC004386 Sequence: MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCL Predict reactive species |
| Full Name | eukaryotic translation initiation factor 4A, isoform 3 |
| Calculated Molecular Weight | 47 kDa |
| Observed Molecular Weight | 47 kDa |
| GenBank Accession Number | BC004386 |
| Gene Symbol | EIF4A3 |
| Gene ID (NCBI) | 9775 |
| RRID | AB_2097394 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P38919 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
EIF4A3 is a component of the exon junction complex (EJC), which assembles near exon-exon junctions of mRNAs as a result of splicing. EJC proteins involves in postsplicing events, including mRNA export, cytoplasmic localization, and nonsense-mediated decay. Its RNA-dependent ATPase and RNA-helicase activities are induced by CASC3, but abolished in presence of the MAGOH/RBM8A heterodimer, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. Besides, it involved in translational enhancement of spliced mRNAs after formation of the 80S ribosome complex and binds spliced mRNA in sequence-independent manner, 20-24 nucleotides upstream of mRNA exon-exon junctions
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for EIF4A3 antibody 10463-1-AP | Download protocol |
| WB protocol for EIF4A3 antibody 10463-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Genes Dev SMG-8 and SMG-9, two novel subunits of the SMG-1 complex, regulate remodeling of the mRNA surveillance complex during nonsense-mediated mRNA decay. | ||
Sci Signal AAA+ proteins RUVBL1 and RUVBL2 coordinate PIKK activity and function in nonsense-mediated mRNA decay. | ||
Cell Biol Toxicol EIF4A3-mediated oncogenic circRNA hsa_circ_0001165 advances esophageal squamous cell carcinoma progression through the miR-381-3p/TNS3 pathway | ||
Biochem Pharmacol CircCRIM1 promotes the translation of HIF-1α protein through its interaction with PTBP3 and enhances malignant progression and angiogenesis in glioblastoma |



















