Product Information
10463-1-PBS targets EIF4A3 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0733 Product name: Recombinant human EIF4A3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC004386 Sequence: MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCL Predict reactive species |
| Full Name | eukaryotic translation initiation factor 4A, isoform 3 |
| Calculated Molecular Weight | 47 kDa |
| Observed Molecular Weight | 47 kDa |
| GenBank Accession Number | BC004386 |
| Gene Symbol | EIF4A3 |
| Gene ID (NCBI) | 9775 |
| RRID | AB_2097394 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P38919 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
EIF4A3 is a component of the exon junction complex (EJC), which assembles near exon-exon junctions of mRNAs as a result of splicing. EJC proteins involves in postsplicing events, including mRNA export, cytoplasmic localization, and nonsense-mediated decay. Its RNA-dependent ATPase and RNA-helicase activities are induced by CASC3, but abolished in presence of the MAGOH/RBM8A heterodimer, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. Besides, it involved in translational enhancement of spliced mRNAs after formation of the 80S ribosome complex and binds spliced mRNA in sequence-independent manner, 20-24 nucleotides upstream of mRNA exon-exon junctions



















