Product Information
68171-1-PBS targets EIF4E3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat, mouse samples.
| Tested Reactivity | human, rat, mouse |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11056 Product name: Recombinant human EIF4E3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC031289 Sequence: MRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH Predict reactive species |
| Full Name | eukaryotic translation initiation factor 4E family member 3 |
| Calculated Molecular Weight | 24 kDa |
| Observed Molecular Weight | 24-30 kDa |
| GenBank Accession Number | BC031289 |
| Gene Symbol | EIF4E3 |
| Gene ID (NCBI) | 317649 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8N5X7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
EIF4E3, also known as Eukaryotic translation initiation factor 4E type 3, is a 224 amino acid protein, which recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis. EIF4E3 acts as a tissue-specific tumor suppressor. For instance, eIF4E3 inhibits expression of both mRNA export and translation targets of eIF4E1, consistent with its nuclear and cytoplasmic localization. Importantly, eIF4E3 overexpression represses oncogenic transformation. (PMID: 23587918).









