EIF4E3 Monoclonal antibody, PBS Only

• 

  WB analysis using 68171-1-Ig (same clone as 68171-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68171-1-Ig (EIF4E3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68171-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 68171-1-Ig (same clone as 68171-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 68171-1-Ig (EIF4E3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68171-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 68171-1-Ig (same clone as 68171-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 68171-1-Ig (EIF4E3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68171-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat colon using 68171-1-Ig (same clone as 68171-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 68171-1-Ig (EIF4E3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68171-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat colon using 68171-1-Ig (same clone as 68171-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 68171-1-Ig (EIF4E3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68171-1-PBS in a different storage buffer formulation.

EIF4E3 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 68171-1-PBS

Clone No.2E9C4

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

eIF 4E type 3, eIF 4E3, eIF4E 3, eIF4E type 3, EIF4E3

---

Product Information

68171-1-PBS targets EIF4E3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat, mouse samples.

• Tested Reactivity: human, rat, mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11056

  Product name: Recombinant human EIF4E3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-118 aa of BC031289

  Sequence: MRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH

• Full Name: eukaryotic translation initiation factor 4E family member 3
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 24-30 kDa
• GenBank Accession Number: BC031289
• Gene Symbol: EIF4E3
• Gene ID (NCBI): 317649
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N5X7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EIF4E3, also known as Eukaryotic translation initiation factor 4E type 3, is a 224 amino acid protein, which recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis. EIF4E3 acts as a tissue-specific tumor suppressor. For instance, eIF4E3 inhibits expression of both mRNA export and translation targets of eIF4E1, consistent with its nuclear and cytoplasmic localization. Importantly, eIF4E3 overexpression represses oncogenic transformation. (PMID: 23587918).