EIF4E3 Monoclonal antibody, PBS Only

EIF4E3 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 68171-1-PBS
Clone No.2E9C4

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat, mouse

Applications

WB, IHC, Indirect ELISA

eIF 4E type 3, eIF 4E3, eIF4E 3, eIF4E type 3, EIF4E3

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68171-1-PBS targets EIF4E3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat, mouse samples.

Tested Reactivity human, rat, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11056

Product name: Recombinant human EIF4E3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-118 aa of BC031289

Sequence: MRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH

Predict reactive species
Full Name eukaryotic translation initiation factor 4E family member 3
Calculated Molecular Weight 24 kDa
Observed Molecular Weight24-30 kDa
GenBank Accession NumberBC031289
Gene Symbol EIF4E3
Gene ID (NCBI) 317649
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8N5X7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EIF4E3, also known as Eukaryotic translation initiation factor 4E type 3, is a 224 amino acid protein, which recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis. EIF4E3 acts as a tissue-specific tumor suppressor. For instance, eIF4E3 inhibits expression of both mRNA export and translation targets of eIF4E1, consistent with its nuclear and cytoplasmic localization. Importantly, eIF4E3 overexpression represses oncogenic transformation. (PMID: 23587918).

Loading...
||
New chat Able
正在加载,请稍候...