Tested Applications
| Positive IHC detected in | human hepatocirrhosis tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 8 publications below |
Product Information
21160-1-AP targets ELOVL6 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14163 Product name: Recombinant human ELOVL6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC001305 Sequence: MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALR Predict reactive species |
| Full Name | ELOVL family member 6, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast) |
| Calculated Molecular Weight | 265 aa, 31 kDa |
| Observed Molecular Weight | 29-32 kDa |
| GenBank Accession Number | BC001305 |
| Gene Symbol | ELOVL6 |
| Gene ID (NCBI) | 79071 |
| RRID | AB_10694572 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H5J4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ELOVL6 antibody 21160-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Clin Transl Med NAT10: An RNA cytidine transferase regulates fatty acid metabolism in cancer cells | ||
Drug Des Devel Ther Selective Inhibition of 11β-Hydroxysteroid Dehydrogenase Type 1 Attenuates High-Fat Diet-Induced Hepatic Steatosis in Mice. | ||
Biochim Biophys Acta Brg1 regulates pro-lipogenic transcription by modulating SREBP activity in hepatocytes. | ||
Animals (Basel) m6A Methylation Mediates the Function of the circRNA-08436/miR-195/ELOVL6 Axis in Regards to Lipid Metabolism in Dairy Goat Mammary Glands | ||
J Clin Invest TRIM56 protects against nonalcoholic fatty liver disease by promoting the degradation of fatty acid synthase |







