ELOVL6 Polyclonal antibody

• 

  IHC staining of human hepatocirrhosis using 21160-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 21160-1-AP (ELOVL6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human hepatocirrhosis using 21160-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 21160-1-AP (ELOVL6 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human hepatocirrhosis using 21160-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 21160-1-AP (ELOVL6 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human brain using 21160-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 21160-1-AP (ELOVL6 antibody) at dilution of 1:100 (under 10x lens).

ELOVL6 Polyclonal Antibody for IHC, ELISA

Cat No. 21160-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

IHC, ELISA

Synonyms

FAE, FACE, ELOVL fatty acid elongase 6, ELOVL FA elongase 6, EC:2.3.1.199

---

Tested Applications

• Positive IHC detected in: human hepatocirrhosis tissue, human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 8 publications below

Product Information

21160-1-AP targets ELOVL6 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14163

  Product name: Recombinant human ELOVL6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-80 aa of BC001305

  Sequence: MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALR

• Full Name: ELOVL family member 6, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast)
• Calculated Molecular Weight: 265 aa, 31 kDa
• Observed Molecular Weight: 29-32 kDa
• GenBank Accession Number: BC001305
• Gene Symbol: ELOVL6
• Gene ID (NCBI): 79071
• RRID: AB_10694572
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H5J4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Clin Transl Med; NAT10: An RNA cytidine transferase regulates fatty acid metabolism in cancer cells; Authors - Mahmood Hassan Dalhat
mouse	WB	Nutrients; Effect of Microbial Status on Hepatic Odd-Chain Fatty Acids Is Diet-Dependent.; Authors - Karolin Weitkunat
mouse	WB	Drug Des Devel Ther; Selective Inhibition of 11β-Hydroxysteroid Dehydrogenase Type 1 Attenuates High-Fat Diet-Induced Hepatic Steatosis in Mice.; Authors - Huashan Li
mouse	WB	Biochim Biophys Acta; Brg1 regulates pro-lipogenic transcription by modulating SREBP activity in hepatocytes.; Authors - Nan Li
rat	WB	Front Pharmacol; Baicalein Prevents Fructose-Induced Hepatic Steatosis in Rats: In the Regulation of Fatty Acid De Novo Synthesis, Fatty Acid Elongation and Fatty Acid Oxidation.; Authors - Pan Li
goat	WB	Animals (Basel); m6A Methylation Mediates the Function of the circRNA-08436/miR-195/ELOVL6 Axis in Regards to Lipid Metabolism in Dairy Goat Mammary Glands; Authors - Yu Wang